PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_48C81DE031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 395aa    MW: 43557 Da    PI: 9.1938
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_48C81DE031.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.66e-29200256259
                             --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                    WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              Dg+nWrKYGqK+vk+s+++rsYYrCt ++C +kkkve++  d++v+ei+Y+g H he
  Traes_7AL_48C81DE031.1 200 GDGFNWRKYGQKQVKSSDNSRSYYRCTNSSCLAKKKVEHCP-DGRVIEIIYRGAHSHE 256
                             6****************************************.***************8 PP

2WRKY33.21e-10368389223
                             --SS-EEEEEEE--TT-SS-EE CS
                    WRKY   2 dDgynWrKYGqKevkgsefprs 23 
                             +Dgy+WrKYGqK vkg+++p s
  Traes_7AL_48C81DE031.1 368 SDGYRWRKYGQKIVKGNPNPSS 389
                             8******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-25188258IPR003657WRKY domain
SuperFamilySSF1182903.66E-23193258IPR003657WRKY domain
PROSITE profilePS5081121.471194258IPR003657WRKY domain
SMARTSM007744.1E-30199257IPR003657WRKY domain
PfamPF031067.1E-22201255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-8361389IPR003657WRKY domain
PROSITE profilePS5081112.966362395IPR003657WRKY domain
SuperFamilySSF1182905.62E-8362389IPR003657WRKY domain
SMARTSM007740.0033367395IPR003657WRKY domain
PfamPF031061.4E-6369389IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
LSSFPWPTAX XXXXXXXXXX XXXXXXXXXX XXXXXXXXET KPEKKAVTET QVKEVSKSGP  60
KEIEKEVKVK VEKENENVEI EATLRPTGAG TEAPPILAVP MLAVPCFIAP PGFAGQFAMS  120
HQAALASVTA QAHIQLQSPA SSAYSEGLPS PFPHPITPKA IRPLQQAPSV TQGSIGRPIA  180
ERPSSSESKL QHHAAVNIVG DGFNWRKYGQ KQVKSSDNSR SYYRCTNSSC LAKKKVEHCP  240
DGRVIEIIYR GAHSHEPPQK TRFVKERSLH IYVPPIGDGT LQLVNTEIVE SRTPTCKLNQ  300
SAAIENSEQQ LFCSSDCEGD VGNKSEDEHR SAESQPKRRI VEATTSNLTP VLRTVRERKI  360
IVQAGKMSDG YRWRKYGQKI VKGNPNPSSN CEASN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-13184258277Probable WRKY transcription factor 4
1wj2_A9e-13184258277Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273960.0KR827396.1 Triticum aestivum WRKY45 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571606.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLW5H7Q90.0W5H7Q9_WHEAT; Uncharacterized protein
STRINGBRADI3G19640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.15e-47WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]